PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100212690161
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 323aa    MW: 36207.7 Da    PI: 6.6731
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100212690161genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-334094155
                       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                  kprl+Wtp+LHerF+eav+qLGG+ekAtPk++l+lm+++gLtl+h+kSHLQkYRl
  Ote100212690161|100212690161 40 KPRLKWTPDLHERFIEAVNQLGGAEKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 94
                                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.9523797IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-313895IPR009057Homeodomain-like
SuperFamilySSF466891.27E-163995IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-244095IPR006447Myb domain, plants
PfamPF002491.7E-104293IPR001005SANT/Myb domain
PfamPF143796.2E-14136177IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MDVSNRMFHH HHHHQGKNMA PPLYLEGVSD SGLVLSTDAK PRLKWTPDLH ERFIEAVNQL  60
GGAEKATPKS VLKLMGIQGL TLYHLKSHLQ KYRLSKNIHG QAYCRSNRNA SGERMPAVNG  120
MITTNQNAAN HTNKNMQLGE AIQMQIQVQR RLHEQLELRI EAQGKYLQSV LEKAQETLGG  180
DNEAAKLQLS DLASKVSTQC LNAAFPDLCQ KHTTQCSIES CLTSSCDQQL YNDLVGFRQP  240
PESEEEMIDH SRMSIGIGVE GDKWSGAEAK FESNDLLKEE KHKTSSSEMK LPFFSTKLDL  300
NTDEENDASS SCKQLDLNGY SWS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094327.11e-141PREDICTED: uncharacterized protein LOC105174060
TrEMBLA0A061F9P81e-113A0A061F9P8_THECC; Homeodomain-like superfamily protein isoform 2
TrEMBLA0A061F2V11e-112A0A061F2V1_THECC; Homeodomain-like superfamily protein isoform 1
STRINGVIT_08s0007g07580.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451